PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G198700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 331aa    MW: 35233.8 Da    PI: 6.58
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G198700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.3e-161564148
                          TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd  lv+ ++++Gg+  +W+  ++  g++R++k+c++rw +yl
  Sobic.006G198700.1.p 15 KGPWTEEEDRALVEHIQRHGGHvgSWRNLPKAAGLNRCGKSCRLRWTNYL 64
                          79**********************************************97 PP

2Myb_DNA-binding56.37.2e-1870114147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg++T +E+ l++++++qlG++ W+tIa ++  gRt++++k++w+++
  Sobic.006G198700.1.p  70 RGNFTDDEESLIIRLHAQLGNK-WSTIATHLD-GRTDNEIKNYWNTH 114
                           89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-23767IPR009057Homeodomain-like
PROSITE profilePS5129417.2651064IPR017930Myb domain
SuperFamilySSF466891.68E-2812111IPR009057Homeodomain-like
SMARTSM007176.7E-121466IPR001005SANT/Myb domain
PfamPF002491.9E-141564IPR001005SANT/Myb domain
CDDcd001673.32E-101764No hitNo description
PROSITE profilePS5129426.65565119IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2668119IPR009057Homeodomain-like
SMARTSM007171.0E-1569117IPR001005SANT/Myb domain
PfamPF002492.7E-1570114IPR001005SANT/Myb domain
CDDcd001674.63E-1272115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRSPCCCHD AGVKKGPWTE EEDRALVEHI QRHGGHVGSW RNLPKAAGLN RCGKSCRLRW  60
TNYLRPDIKR GNFTDDEESL IIRLHAQLGN KWSTIATHLD GRTDNEIKNY WNTHIRKKLL  120
RMGVDPVTHQ RLPPDDIAIA SVPGAAILSA AASLGGLNTA LIQVQALQLL LQAVNGGGGN  180
AAAAAAAGLI PSINAAAADN AILNANRRSI VPSFQDQMNL ILSHANYASP DHLSNIASFA  240
EQHDVVVQRL NNASSAAPVV GGAYAEPLAA ALASAATYPP QEVAASADRP VQGFAELLSE  300
PIGMPSMCSL EDDEDAFWKN MLLESSSLPL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-27151194105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-27151194105C-Myb DNA-Binding Domain
1msf_C2e-27151194105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794320.0HF679432.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB26 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105856.11e-163transcription factor MYB2
SwissprotQ8GWP05e-69MYB39_ARATH; Transcription factor MYB39
TrEMBLQ2A7041e-163Q2A704_MAIZE; Transcription factor MYB2
TrEMBLK7U6D71e-163K7U6D7_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G081557_P011e-162(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62652955
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-69myb domain protein 9